PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G276000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 366aa    MW: 40119.8 Da    PI: 4.195
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G276000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM57.64.3e-18111385128
                 NAM   5 frFhPtdeelvveyLkkkvegkkleleev.ikevdiy.kvePwdLpk....kvkaeek.ewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +rF+ t  e v ++L + ++g++l+ +e  i+++diy ++eP+dL +    + ka+++   +fF+ +++++ + +r+ r++ +g+W  + k
  Brast05G276000.1.p  11 CRFDLTPLEAVAYFLPRLLSGETLHGAERfIHRADIYgQLEPKDLAAafppANKADRTgARFFFTLSKRQKGSRSRSARSAGAGTWTIQ-K 100
                         6999999****************7765555******9456*****8446653334444366*************************965.6 PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         + ++ ++ g ++g  k L f +++++  e++ Wvm+eyr 
  Brast05G276000.1.p 101 TIDINDEAGVKKGEEKKLSFKSKKDK--ESSGWVMEEYRC 138
                         799***9*************955555..59********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100518.8047158IPR003441NAC domain
PfamPF023651.1E-911137IPR003441NAC domain
SuperFamilySSF1019413.4E-1712157IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MELDMEVFAL CRFDLTPLEA VAYFLPRLLS GETLHGAERF IHRADIYGQL EPKDLAAAFP  60
PANKADRTGA RFFFTLSKRQ KGSRSRSARS AGAGTWTIQK TIDINDEAGV KKGEEKKLSF  120
KSKKDKESSG WVMEEYRCLL PEAVVEDGEM VLCKIHLSHS ACSKKARQRS AARRLSGTGS  180
QEQEDQPPPM AAATAKRPAP VDSDDLPCAK RARVAAAEAD HSQDMDGFRS SLEDLVAEQD  240
EPAADSMDGR FSCTMEELLG GAATDEEQQD ATLPAVEAEE QMVDFDFNLD DLPVLDDDAL  300
GEIMLSLDDE AEQLRGVDLP IASDEGFDFE LPTDEELDAM ISNLQENWPV SFAPDGDLIR  360
IPAVL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010239527.11e-147PREDICTED: uncharacterized protein LOC104585199
TrEMBLA0A0Q3HFY01e-148A0A0Q3HFY0_BRADI; Uncharacterized protein
STRINGBRADI4G43020.11e-147(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP18322799